
Found 17 Documents

Pendidikan Bahasa Inggris Vol 2, No 2 (2013): Jurnal Mahasiswa Bahasa Inggris Genap 2012-2013
Publisher : Pendidikan Bahasa Inggris

Show Abstract | Download Original | Original Source | Check in Google Scholar


ABSTRAKMakalah ini ditulis bertujuan untuk membantu mengatasi salah satu dari permasalahan yang ada dalam pengajaran mendengar (listening) pada Sekolah Menengah Atas  (SMA). Selain itu makalah ini juga dimaksudkan sebagai masukan bagi guru-guru bahasa Inggris dalam melaksanakan pembelajaran listening sehingga siswa tertarik dan termotivasi untuk belajar listening khususnya procedure text.            Dalam makalah ini, penulis membahas bagaimana pengajaran listening melalui penggunaan kombinasi SLANT strategy  dan TQLR strategy. Strategi kombinasi ini memepermudah guru meningkatkan keinginan siswa dalam mendengar dan memahami pesan yang disampaikan oleh pembicara.SLANT strategy membantu siswa untuk lebih siap sebelum mendengarkan teks dan membantu memahami teks melalui mencatat ide-ide pokok yang di sampaikan oleh pembicara. Prosedur SLANT yaitu Sit Up:siswadudukdenganposisi yang tepat, Lean Forward:siswamenyiapkandiriuntukbelajar, Activate Thinking :siswamengaktifkanpikiranmengaitkanpengetahuandenganmateri yang akan di pelajari, Note Key Idea : siswamencatat ide pokokdan Track the Speaker :siswamelakukantanyajawabdengan guru tentangmateri yang telahdipelajari. TQLR strategy membantu siswa untuk mangaktifkan pikiran dan membuat pertanyaan tentang  topik yang akan di dengar. Hal ini dapat membantu siswa lebih mudah untuk menangkap pesan dari pembicara. Prosedur TQLR yaitu Tune in :siswamenebakmateripembelajaranmelaluigambar yang ditampilkanoleh guru, Question: siswamembuatpertanyaan yang berhubungandenganmateri yang akan di pelajari, Listen :siswamendengarkanrekamandan Review : siswadan guru melakukandiskusidanmemberipenguatanterhadapmateri yang telahdipelajari.
Faktor-faktor yang mempengaruhi tingginya Keterwakilan perempuan pada pemerintahan Desa Tambun Arang Mardiana, Mardiana; Miranti, Miranti; Maryam, Siti
Jurnal Politik dan Pemerintahan Daerah Vol 1, No 1 (2019): Juni
Publisher : Universitas Muara Bungo

Show Abstract | Download Original | Original Source | Check in Google Scholar | Full PDF (20.373 KB) | DOI: 10.36355/jppd.v1i1.3


Perempuan memiliki peran vital di dalam kehidupan. Untuk menghadapi perkembangan jaman, di era ke-21 ini perempuan juga tak kalah dengan kaum laki-laki. Pada pemerintahan pun perempuan banyak yang menduduki jabatan. Penelitian ini bertujuan untuk menganalisis factor-faktor yang mempengaruhi tingginya keterwakilan perempuan pada pemerintahan Desa Tambun Arang. Penelitian ini merupakan penelitian deskriptif kualitatif. Hasil penelitian menunjukkan bahwa faktor-faktor yang mempengaruhi tingginya keterwakilan perempuan dalam pemerintahan Desa Tambun Arang adalah ketokohan dalam masyarakat dan kekuatan untuk menyerap aspirasi perempuan. Program yang telah dilakukan untuk perempuan di Desa Tambun Arang diantaranya yaitu Senam Tebo, Peralatan Prasmanan, Kursus menjahit dan Memasak, Pertemuan mingguan dan yasinan.
Pastura : Jurnal Ilmu Tumbuhan Pakan Ternak Vol 1 No 2
Publisher : Udayana University

Show Abstract | Download Original | Original Source | Check in Google Scholar | Full PDF (274.563 KB) | DOI: 10.24843/Pastura.2012.v01.i02.p01


Research activities have been carried out to study the role of fodder plant terrace in the Canggal village, kecamatan Kledung, kabupaten Temanggung. It is located on a plateau with slope range between 15-45%. Treatment aims were to conserve the slopes land with grass fodder crops by planting terrace with grass. The measurement was done on the soil erosion which belongs to the rorak made on each end of the strip. The results showed that planting in slopes areas with grass strips reduced erosion rate by 26%. With the planting strip of grass, still showed the existence of differences in erosion in different precipitation levels. But with a strip of grass, the rate of erosion on the slope of 30-45% can be pressed to no different than land that has a slope of 15-25%. Technology of strengthening terrace as part of the conservation of wetlands has been adopted by cooperator farmers and growing to non cooperators.
Meningkatkan Hasil Belajar siswa pada mata pelajaran PKn di Kelas III SDN Paranggi Kecamatan Ambpibabo Melalui Metode Pemberian Tugas Individu Miranti, Miranti; Imran, Imran; Firmansyah, Arif
Jurnal Kreatif Tadulako Online Vol 5, No 12 (2017): Jurnal Kreatif Tadulako Online
Publisher : Jurnal Kreatif Tadulako Online

Show Abstract | Download Original | Original Source | Check in Google Scholar


Penelitian  ini  adalah  penelitian tindakan  kelas dengan menerapkan  Model Pembelajaran pemberian tugas individual .Metode pemberian tugas adalah suatu cara mengajar yang dicirikan oleh adanya kegiatan perencanaan antara murid dengan guru mengenai suatu persoalan atau problema yang harus diselesaikan/dikuasai oleh murid dalam jangka waktu tertentu yang disepakati bersama antara murid dan guru. Masalah yang  hendak  dipecahkan  dalam  penelitian  ini  adalah  apakah  dengan  model pembelajaran pemberian tugas individu dapat  meningkatkan hasil belajar siswa di kelas III SDN Paranggi.  Penelitian  ini  terdiri  dari dua siklus, pada setiap siklus terdiri dari  empat  tahap  yaitu : perencanaan, pelaksanaan, observasi, dan refleksi. Penelitian  ini  melibatkan 18 siswa  dikelas III SDN Paranggi, yang  tediri  dari 10  siswa  laki-laki dan 8  siswa  perempuan Hasil  penelitian  menunjukkan  bahwa  terjadi  peningkatan hasil belajar siswa seiring  dengan  diterapkannya  model pembelajaran pemberian tugas individu  yakni  dapat  dilihat  dari  hasil  observasi aktivitas siswa yang  diperoleh  pada  siklus I, yakni  56,25% dan  75,00%, serta aktifitas  siswa  dalam kategori cukup. Pada  siklus  II  diperoleh 75,00% dan 87,50% dengan  peningkatan aktifitas siswa berada dalam kategori sangat baik dan hasil belajar siswa pada siklus I yang diperoleh daya serap klasikal yaitu 70,56% dan pada siklus II daya serap klasikal 80,56%  Dengan demikian, berdasarkan hasil penelitian  menunjukkan bahwa penggunaan metode pemberian tugas individu dapat meningkatkan hasil belajar siswa  di kelas III SDN  Paranggi. Kata Kunci: Peningkatan Hasil Belajar Siswa; Metode Pemberian Tugas Individu
Jurnal Online Mahasiswa (JOM) Bidang Keguruan dan Ilmu Pendidikan Vol 5: Edisi 2 Juli-Desember 2018
Publisher : Jurnal Online Mahasiswa (JOM) Bidang Keguruan dan Ilmu Pendidikan

Show Abstract | Download Original | Original Source | Check in Google Scholar


Abstract: This study aims to determine the effect of outbound stepping carpet on interpersonal intelligence in children aged 5-6 years in TK Bina Mandiri Rambah Hilir District Rokan Hulu District. The research used experimental method with one group pre-test post-test design. The sample used in this study were 18 students. The data collection technique used is observation. Technique of data analysis using t-test test by using program of SPSS 23. The research hypothesis is that there is influence of outbound stepping carpet toward interpersonal intelligence in children aged 5-6 years in TK Bina Mandiri Kecamatan Rambah Hilir Rokan Hulu Regency. Based on data analysis known tcalculated = 15,605> ttable = 2,110 with Sig. (2-tailed) = 0,000. Because Sig <0,05 it can be concluded that there are differences of interpersonal intelligence before and after done outbound stepping carpet. It can be interpreted that there is influence of outbound stepping carpet activity toward interpersonal intelligence in children aged 5-6 years in TK Bina Mandiri Subdistrict Rambah Hilir Rokan Hulu significant as much as 48.26%.Keyword: Interpersonal Intelligence, Outbound Stepping Carpet Activities
Healthy Tadulako Vol 5, No 1 (2019)
Publisher : Healthy Tadulako

Show Abstract | Download Original | Original Source | Check in Google Scholar


Penurunan massa otot dan kekuatan otot pada individu lanjut usia menjadi masalah aditif dengan prevalensi yang tinggi. Menilai kehilangan massa otot dan kekuatan otot yang berhubungan dengan usia serta menentukan mekanisme terjadinya atrofi otot pada proses penuaan, struktur otot dan komposisi serat otot telah dilakukan, dengan menggunakan teknik invasif dan noninvasif. Penurunan ukuran volume secara bertahap seiring bertambahnya usia, disertai penggantian oleh jaringan lemak dan ikat. Penurunan massa otot dan kekuatan otot, tampaknya disebabkan oleh pengurangan jumlah dan ukuran serabut otot, terutama tipe 2, dan sampai batas tertentu disebabkan oleh proses neurogenik progresif perlahan. Memperbaiki penurunan massa dan kekuatan otot dapat dilakukan dengan meningkatkan kekuatan otot yaitu dengan olahraga
Jurnal Online Mahasiswa (JOM) Bidang Keguruan dan Ilmu Pendidikan VOL 6 : EDISI 2 JULI - DESEMBER 2019
Publisher : Jurnal Online Mahasiswa (JOM) Bidang Keguruan dan Ilmu Pendidikan

Show Abstract | Download Original | Original Source | Check in Google Scholar


Abstact: This research was conducted to analyze item quality of written test for Senior High School in Biology Olimpiad at Riau dan Kepulauan Riau 2018. This research was carried out in October – November 2018. This research is a descriptive research, the data analyzed by quantitative method composed by difficult level, distinguishing power, fungtion of distractor, validity and reliability item and see domain cognitive by Taksonomi Bloom. Data source in this research are secondary data used participant answer sheet as the data. The result of quntitative method show that written test in the bad category based on clasification qualitative analyze, because only 15 items accepted, 76 items need to repaired and 9 items was rejected.Key Words: Analysis Item Quality, Wtitten Test, Taksonomi Bloom
VARIANCE : Journal of Statistics and Its Applications Vol 1 No 1 (2019)
Publisher : Statistics Study Programme, Department of Mathematics, Faculty of Mathematics and Natural Sciences, University of Pattimura

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.30598/variancevol1iss1page17-26


Traffic accidents are one of the main causes of the highest increase in mortality in Indonesia. This problem needs attention to anticipate the fall of the death toll in a traffic accident. So in this study, there are response variables and several predictor variables. The purpose of this study was to find out what factors influence the severity of traffic accident victims in Ambon city based on categories and model the severity of traffic accident victims in Ambon city based on significant factors using the Multinomial Logistic Regression method. In this study, the results obtained are factors that significantly affect the severity of the traffic accident victims are sex variables (X1), age (X1), education (X3) and type of vehicle (X5).
Jurnal Kesehatan Masyarakat (e-Journal) Vol 6, No 1 (2018): Jurnal Kesehatan Masyarakat (E-Journal)
Publisher : Fakultas Kesehatan Masyarakat

Show Abstract | Download Original | Original Source | Check in Google Scholar | Full PDF (128.418 KB)


Incidents are event that result in an accident or a near-miss event. The cause of the incidence can be found by incident investigation methods to prevent future incidents ought to be the same. Terminal LPG Semarang (TLS) is a company with high hazard potential. TLS uses SCAT to investigate the cause of incident. SCAT is a secondary method that identify the problem at the management and safety culture so operational and human error factors are not identified. Tripod is a primary method that identify the problem on organizational, operational, and human error factors. This descriptive research aims to describe the comparison of incident cause investigation results using SCAT and Tripod method. Data obtained using the technique of in depth interview and secondary data collection. The main informants in this study were 14 workers involved in the incident. The triangulation informant is a 4 person investigators who investigate the incidents. The result showed that there is equation of result in identification of immediate cause between SCAT method and Tripod method but there is difference of result in identification of barrier, precondition, underlying cause, and recommendation between SCAT method and Tripod method. From these results the company is expected to conduct in depth analysis of appropriate incident investigation methods for the company.
Satuan Polisi Pamong Praja Kabupaten Bungo : Analisis Kritis Atas Penempatannya Berdasarkan Peraturan Daerah Kabupaten Bungo No 8 Tahun 2013 tentang Perubahan Atas Peraturan Daerah No 2 Tahun 2011 tentang Pembentukan dan Susunan Organisasi Lembaga Teknis Daerah Ridwan, Ridwan; Miranti, Miranti; Santoso, Puji
Jurnal Administrasi Sosial dan Humaniora Vol 2, No 2 (2017): Juni
Publisher : Sekolah Tinggi Ilmu Administrasi Setih Setio Muara Bungo

Show Abstract | Download Original | Original Source | Check in Google Scholar


Penelitian ini bertujuan untuk mengetahui bagaimana penempatan dan tugas Satpol-PP dalam penegakan peraturan daerah dan untuk mengetahui faktor apa yang menjadi kendala dan hambatan dalam menjalankan tugas berdasarkan Peraturan Daerah Nomor 8 Tahun 2013Tentang Perubahan Atas Peraturan Daerah Nomor 2 Tahun 2011 Tentang Pembentukan Dan Susunan Organisasi Lembaga Teknis Daerah. Penelitian ini dilaksanakan di Kantor Satuan Polisi Pamong Praja (Satpol PP) di Kabupaten Bungo. Untuk mencapai tujuan tersebut penulis menggunakan teknik pengumpulan data berupa penelitian lapangan dengan melakukan wawancara langsung terhadap narasumber pada instansi tersebut. Hasil penelitian ini menunjukkan bahwa: dalam menjalankan tugas berdasarkan Perda No 8 Tahun 2013 Satuan Polisi Pamong Praja (Satpol PP) mempunyai acuan yaitu berdasarkan peraturan perundang-undangan baik peraturan pemerintah secara nasional maupun peraturan-peraturan daerah dalam melaksanakan tugasnya berkaitan dengan peraturan daerah Kabupaten Bungo. Langkah yang ditempuh yaitu dengan berpedoman pada pelaksanaan teknis operasional Pembinaan ketentraman dan ketertiban umum dengan bekerjasama dengan aparat penertiban lainnya. Faktor yang mempengaruhi penegakkan peraturan daerah Kabupaten Bungo oleh satuan Polisi Pamong Praja dalam lingkup Pemerintah Daerah yaitu antara lain kualitas sumber daya manusia serta sarana dan prasarana.